• 19 Feb 26

VSA Capital Technology & Transitional Energy 190226

VSA Capital Technology & Transitional Energy 190226

Seraphim Space Investment Trust Plc, 181 | BAE Systems plc, 1,784 | ITM Power PLC, 115 | AFC Energy plc, 11.4 | SuperSeed Capital Limited GBP, 0 | Aurrigo International PLC, 68.5

    • 170 views

 

Enjoying this article?

Get a £25 credit by sharing with your friends and colleagues via our Refer a Friend page. Each new subscriber gets a 10% discount and you get a free month off your bill every time.


Don't worry, if you're a Lite-Access/Free user we save all your credits for the day you decide to fully subscribe.


 

James Bruegger, CIO for Seraphim Space (SSIT); Why the SpaceX IPO changes everything for investors

Companies: Seraphim Space Investment Trust Plc

Vox Markets Video Wrap

Companies: QDEALUVTYCHHTIDEDGEAVGIQESFTITRKANCRITMJET2EXPNDNLMPINEFRASEZJHVOFDEVBBSNRMVGMSBRCKTUNEAUTOBKSPMIDCCSAGACLXRPIVRCIWISE

VSA Capital Morning Miner x Tech Special w. David Keene of Aurrigo 180626

Companies: HALOGSVRCTLSMLPATATMPLSRAURR

VSA Capital Tech & Transitional Energy 120326

Companies: AVONHLMAITMQEDCCCTSMWFAURRAMCO

VSA Capital Tech & Transitional Energy 110626

Companies: SSITCNCHLMAOXIGCWRGROW

VSA Capital Technology & Transitional Energy 050226

Companies: 0R2T0XGHADBE0R1IFTCITMPOLRCYANNESFAMD0RIH0QYP

© Research Tree 2026

  • Apple Store
  • Play Store

Research Tree will never share your details with third parties for marketing purposes. Research Tree distributes research documents that have been produced and approved by Financial Conduct Authority (FCA) Authorised & Regulated firms as well as relevant content from non-authorised sources, who are not regulated but the information is in the public domain. For the avoidance of doubt Research Tree is not giving advice, nor has Research Tree validated any of the information.

Research Tree is an Appointed Representative of Sturgeon Ventures which is Authorised and Regulated by the Financial Conduct Authority.

Top