• 12 Mar 26

VSA Capital Tech & Transitional Energy 120326

VSA Capital Tech & Transitional Energy 120326

Avon Technologies PLC, 1,782 | Halma plc, 3,900 | ITM Power PLC, 112 | Quadrise PLC, 1.7 | Computacenter Plc, 4,258 | Taiwan Semiconductor Manufacturing Co., Ltd., 0 | Aurrigo International PLC, 68.5 | Amcomri Group Plc, 144

    • 136 views

 

Enjoying this article?

Get a £25 credit by sharing with your friends and colleagues via our Refer a Friend page. Each new subscriber gets a 10% discount and you get a free month off your bill every time.


Don't worry, if you're a Lite-Access/Free user we save all your credits for the day you decide to fully subscribe.


 

VSA Capital Morning Miner x Tech Special w. David Keene of Aurrigo 180626

Companies: HALOGSVRCTLSMLPATATMPLSRAURR

Vox Markets Video Wrap

Companies: QDEALUVTYCHHTIDEDGEAVGIQESFTITRKANCRITMJET2EXPNDNLMPINEFRASEZJHVOFDEVBBSNRMVGMSBRCKTUNEAUTOBKSPMIDCCSAGACLXRPIVRCIWISE

VSA Capital Tech & Transitional Energy 110626

Companies: SSITCNCHLMAOXIGCWRGROW

Quadrise Fuels International get set for AGM to seize upon opportunities in 2021

Companies: Quadrise PLC

VSA Capital Tech & Transitional Energy 040626

Companies: CHGIES0ADFAURR

Quadrise Chairman provides update, confirms progress on key projects and leadership transition

Companies: Quadrise PLC

© Research Tree 2026

  • Apple Store
  • Play Store

Research Tree will never share your details with third parties for marketing purposes. Research Tree distributes research documents that have been produced and approved by Financial Conduct Authority (FCA) Authorised & Regulated firms as well as relevant content from non-authorised sources, who are not regulated but the information is in the public domain. For the avoidance of doubt Research Tree is not giving advice, nor has Research Tree validated any of the information.

Research Tree is an Appointed Representative of Sturgeon Ventures which is Authorised and Regulated by the Financial Conduct Authority.

Top