• 26 Jun 26

2 P's on a Pod: Is UK Takeover Activity Just Getting Started?

2 P's on a Pod: Is UK Takeover Activity Just Getting Started?

Moonpig Group Plc, 230 | Carclo plc, 33.2 | Advanced Medical Solutions Group plc, 279 | McBride plc, 151 | Telecom Plus PLC, 777 | Avingtrans plc, 590 | Volex plc, 542 | ITV PLC, 81.6 | Halfords Group Plc, 218 | IP Group plc, 64.2 | Severfield Plc, 32.1 | SEGRO plc, 885 | easyJet plc, 579 | Ramsdens Holdings PLC, 590 | Distribution Finance Capital Holdings Plc, 65.5 | NIOX Group Plc, 56.7 | BRCK Group PLC, 49.6 | Spire Healthcare Group PLC, 218 | Gamma Communications PLC, 846 | Gear4music (Holdings) PLC, 282

    • 50 views

 
In this week’s live smallcap show, UK equity analyst & markets commentator Paul Scott & I discussed our latest thoughts on 22 stock ideas.

Enjoying this article?

Get a £25 credit by sharing with your friends and colleagues via our Refer a Friend page. Each new subscriber gets a 10% discount and you get a free month off your bill every time.


Don't worry, if you're a Lite-Access/Free user we save all your credits for the day you decide to fully subscribe.


 

Vox Markets Weekly Video Wrap

Companies: QHEMOONRIFTCARAMSMCBTEPAVGVLXITVHFDIPOSFREZJRFXBRESDFCHBRCKGAMAG4M

McBride plc: A strategic, earnings-accretive acquisition - 7 April 2026

Companies: McBride plc

VSA Capital Tech & Transitional Energy 250626

Companies: 0R2TIGPFTCAVGVLXDIAWPHO

Vox Markets Video Wrap

Companies: QDEALUVTYCHHTIDEDGEAVGIQESFTITRKANCRITMJET2EXPNDNLMPINEFRASEZJHVOFDEVBBSNRMVGMSBRCKTUNEAUTOBKSPMIDCCSAGACLXRPIVRCIWISE

Ramsdens, IP Group, Metals One, Tertiary Minerals - Small Cap Snapshot

Companies: Ramsdens Holdings PLC

2 P's on a Pod: M&A Themes, Software Winners & Retail Reality

Companies: SKLSDGELCOIGPGBGTTGTATETEPSYNTTRCSASAICWREYETETSHOEW7LEVOKAOMDCCATG

© Research Tree 2026

  • Apple Store
  • Play Store

Research Tree will never share your details with third parties for marketing purposes. Research Tree distributes research documents that have been produced and approved by Financial Conduct Authority (FCA) Authorised & Regulated firms as well as relevant content from non-authorised sources, who are not regulated but the information is in the public domain. For the avoidance of doubt Research Tree is not giving advice, nor has Research Tree validated any of the information.

Research Tree is an Appointed Representative of Sturgeon Ventures which is Authorised and Regulated by the Financial Conduct Authority.

Top