• 18 Mar 26

2Ps on a Pod — Is M&A Activity in UK Small Caps Telling Us Something the Market Isn't?

2Ps on a Pod — Is M&A Activity in UK Small Caps Telling Us Something the Market Isn't?

Fonix plc, 152 | CAB Payments Holdings PLC, 79.0 | Vistry Group PLC, 265 | Eleco Plc, 118 | Intercede Group plc, 108 | Close Brothers Group plc, 447 | Victrex plc, 597 | Zotefoams plc, 421 | ITV PLC, 81.6 | M&C Saatchi plc, 134 | System1 Group PLC, 311 | TP ICAP Group plc, 340 | Funding Circle Holdings Plc, 145 | Eagle Eye Solutions Group PLC, 450 | Spire Healthcare Group PLC, 218 | Intuitive Investments Group Plc, 300 | Somero Enterprises, Inc., 190 | Trustpilot Group Plc, 240

    • 146 views

 
In this week’s live smallcap show, UK equity analyst & markets commentator Paul Scott & I discussed our latest thoughts on 21 stock ideas.

Enjoying this article?

Get a £25 credit by sharing with your friends and colleagues via our Refer a Friend page. Each new subscriber gets a 10% discount and you get a free month off your bill every time.


Don't worry, if you're a Lite-Access/Free user we save all your credits for the day you decide to fully subscribe.


 

Vox Markets Weekly Video Wrap

Companies: QHEMOONRIFTCARAMSMCBTEPAVGVLXITVHFDIPOSFREZJRFXBRESDFCHBRCKGAMAG4M

Vox Markets Video Wrap

Companies: QDEALUVTYCHHTIDEDGEAVGIQESFTITRKANCRITMJET2EXPNDNLMPINEFRASEZJHVOFDEVBBSNRMVGMSBRCKTUNEAUTOBKSPMIDCCSAGACLXRPIVRCIWISE

2 P's on a Pod: Is UK Takeover Activity Just Getting Started?

Companies: MOONCARAMSMCBTEPAVGVLXITVHFDIPOSFRSGROEZJRFXDFCHNIOXBRCKSPIGAMAG4M

2 P's on a Pod: M&A Themes, Software Winners & Retail Reality

Companies: SKLSDGELCOIGPGBGTTGTATETEPSYNTTRCSASAICWREYETETSHOEW7LEVOKAOMDCCATG

VSA Capital Tech & Transitional Energy 250626

Companies: 0R2TIGPFTCAVGVLXDIAWPHO

Eagle Eye (EYE) Capital Markets Day November 2018

Companies: Eagle Eye Solutions Group PLC

© Research Tree 2026

  • Apple Store
  • Play Store

Research Tree will never share your details with third parties for marketing purposes. Research Tree distributes research documents that have been produced and approved by Financial Conduct Authority (FCA) Authorised & Regulated firms as well as relevant content from non-authorised sources, who are not regulated but the information is in the public domain. For the avoidance of doubt Research Tree is not giving advice, nor has Research Tree validated any of the information.

Research Tree is an Appointed Representative of Sturgeon Ventures which is Authorised and Regulated by the Financial Conduct Authority.

Top