• 18 Dec 25

VSA Capital Tech & Transitional Energy 181225

VSA Capital Tech & Transitional Energy 181225

Netcall plc, 116 | Filtronic plc, 278 | ITM Power PLC, 133 | Chesterfield Special Cylinders Holdings PLC, 34.0 | Ilika plc, 29.0 | Tekmar Group Plc, 14.5 | Nano One Materials Corp, 0

    • 255 views

 

Enjoying this article?

Get a £25 credit by sharing with your friends and colleagues via our Refer a Friend page. Each new subscriber gets a 10% discount and you get a free month off your bill every time.


Don't worry, if you're a Lite-Access/Free user we save all your credits for the day you decide to fully subscribe.


 

VSA Capital Tech & Transitional Energy 250626

Companies: 0R2TIGPFTCAVGVLXDIAWPHO

Vox Markets Video Wrap

Companies: QDEALUVTYCHHTIDEDGEAVGIQESFTITRKANCRITMJET2EXPNDNLMPINEFRASEZJHVOFDEVBBSNRMVGMSBRCKTUNEAUTOBKSPMIDCCSAGACLXRPIVRCIWISE

VSA Capital Tech & Transitional Energy 180626

Companies: SEEIQETGPSPECIES

Executive interview – Ilika

Companies: Ilika plc

Vox Markets Weekly Wrap

Companies: KOOFTCVIDCPIBRESFCHTETMERCVANLWATRMET1MPAL

Tekmar Group (TGP) H1 results presentation December 2020

Companies: Tekmar Group Plc

© Research Tree 2026

  • Apple Store
  • Play Store

Research Tree will never share your details with third parties for marketing purposes. Research Tree distributes research documents that have been produced and approved by Financial Conduct Authority (FCA) Authorised & Regulated firms as well as relevant content from non-authorised sources, who are not regulated but the information is in the public domain. For the avoidance of doubt Research Tree is not giving advice, nor has Research Tree validated any of the information.

Research Tree is an Appointed Representative of Sturgeon Ventures which is Authorised and Regulated by the Financial Conduct Authority.

Top