• 25 Feb 26

2 P’s on a Pod: Takeover Tensions, AI Shockwaves & Small Cap Opportunities

2 P’s on a Pod: Takeover Tensions, AI Shockwaves & Small Cap Opportunities

UNITE Group plc, 523 | Synectics PLC, 200 | ME Group International plc, 103 | Avingtrans plc, 580 | Checkit plc, 21.5 | Jet2 PLC, 1,357 | Tracsis plc, 315 | SDI Group plc, 89.5 | Augmentum Fintech PLC, 0 | Pulsar Group PLC, 38.5 | Trainline Plc, 207 | Spire Healthcare Group PLC, 219 | Warpaint London PLC, 210 | Cerillion Plc, 1,120

    • 234 views

 
In this week’s live smallcap show, UK equity analyst & markets commentator Paul Scott & I discussed our latest thoughts

Enjoying this article?

Get a £25 credit by sharing with your friends and colleagues via our Refer a Friend page. Each new subscriber gets a 10% discount and you get a free month off your bill every time.


Don't worry, if you're a Lite-Access/Free user we save all your credits for the day you decide to fully subscribe.


 

VSA Capital Tech & Transitional Energy 250626

Companies: 0R2TIGPFTCAVGVLXDIAWPHO

Cerillion (CER) Full Year 20 results presentation given at ShareSoc 30.11.20

Companies: Cerillion Plc

Vox Markets Video Wrap

Companies: TUNACGSAASENSIONDOVTYCNCELCOTATEZTFITRKVLEPAYEOGGRISRTTPTGATCZOOCRWBVXPHVOKMKXPFTPFGNIOXPEBBSPIGAMAOTBRMRCRDLBKSTBTGGWMOCTAMPALATGLST

Cerillion (CER) FY23 Results presentation - November 23

Companies: Cerillion Plc

2 P's on a Pod: Is M&A a Key Signal in Equity Markets Right Now?

Companies: SAASVTYTATEITRKVLEGRITPTGATCCRWHVOKMKXPFTPFGPEBBSPIGAMAOTBCRDLCTAATG

2 P’s on a Pod: Small Cap Investing with Paul Hill & Paul Scott

Companies: ALUCRPRAVGIQEITRKANCRITMDNLMEZJHVOFDEVGMSBRCKPMIBOOMCLXRPI

© Research Tree 2026

  • Apple Store
  • Play Store

Research Tree will never share your details with third parties for marketing purposes. Research Tree distributes research documents that have been produced and approved by Financial Conduct Authority (FCA) Authorised & Regulated firms as well as relevant content from non-authorised sources, who are not regulated but the information is in the public domain. For the avoidance of doubt Research Tree is not giving advice, nor has Research Tree validated any of the information.

Research Tree is an Appointed Representative of Sturgeon Ventures which is Authorised and Regulated by the Financial Conduct Authority.

Top